Dataset for protein Bcl-xL of organism Gallus gallus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************  *  . .  .*    .* ::  ::: * :    .:: *         ****          .*.
DVRQALRDAGDEFELryRrafsdltsQlhitpGtayqsfeqvVnelfhdgvnwGrivaffsfgGALC----------vEs
               -- gfvrgerg gdagt gthcvlddh ldrpsrsldp ewrl-----    gsvweqrccra e

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ::. :.      ** .*        :: **:     ** *:                 * ...* :  *::*    .
vdkemrvlv------GRivSwmttyltdhldPWiqe-ngGWeRfvdlygnnaaaelrkgqeTfnkwLltgaTvaGvlllg
gpgdlqqmaphrgdr  sa -agipaepqvt  lcplap  l l----------------h sttq psti it rsprs

       250   
....:....|...
: *. .       
slLsrk-------
te pssrrqllls
© 1998-2019