Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
---------------------------------fhsegshtttegalplmatfksgderkprptelgrgrlvnksqddqs
mlsqkltsnygtslvqtcwfnspqnggeernmd---------------------------------------------me
                                 msidt msisnre vffflshklsq ny  ipfqpegagegtde k 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .                       : ::   :         .      .   :   ::*      .: .  .:   :. 
gr-----------------------ldndtlrliriflrdyagaskakrtrqdevqvtmRrv----vdgvlekhqyaykg
nngslpstpelqsevdtdsqageeviwkngkaiseg-----tastqtapsptsqsteav glllesaqemerryylrfsd
c                         g e    nddy lscn nggl  p pp gaa   aa     edf lq ta  qa

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ..      .   . . .* ..:. *.  ****:..*.:* ..*.     .                         :**
miqkllldgrgedmsfvtsVmkslfaDsttNWGRivsLvaFggaLcqyleergkegc-----------------vslvAE
lsss-epqtpataygslrk aeevvr g-l    vag ft tav avqcvakkmvqmgqdpgtgralgqvpggscrrl  
 a qf aice d cagfe     g  qi                re q  egshl                  pg   

       250       260       270       280       290       300        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
 :: ** .    *: .*..*: *  .             ::  .  *.. * .        ** .   
eissYLlsdqreWlvkNnsWegFveff-------rvsdpettvrntLmafAgfagiglt-aLLir---
wmtr  gehkdh iqs gg kh ckv-gsdsrigarvtrdssrkwm vga lvtivlagif  vkkhv
t ad  ddei d  le       aa     aaaa ernq  hm ta    lg a       a    
© 1998-2019