Dataset for protein BCL-2-like of organism Fundulus heteroclitus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :.   :         .     :                                                 
--maptnrqlvncyisqklsqrgyp--rpglrlpevemssssgd-------------------------qesr------s
msksyssteiaeslvkyngvkdnqahy-nyvqr---a-dgg-e-lrwdcskrpknlrvmarngfavksi--n-ddgslp-
 m-nsqpsh  lrkmfhg wgttv wrvdsmmdsdp-s---l-                          rs-tlvrtcrt
  amre  d  gn   f    e c vaf hil n apgnrter                          kdppeeqraed
   cdc      f   c          e     d   a   a                           a  d      a
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .                 :*                        :.   .   :  :    *   
tp--qadsesagspsragqpaldsdttelisgalRd--------------------vaeeleslhryaftgmsrq-Lnit
-anm-----a--cgrh---ewastpppsavkvfm eftglsghrwytkkslstmkrtvddflrkyqrsyshliqkf yld
s-egtvvqt-s ---qvssrpsqpgrmaephsv  r                    sgq v lrftqr ne hst  rhs
hs  ppngswd d w rrgqlpphaah d ar                        l c   hq ald hd als  h  
a   alg d       cq  h a   a    a                        a         a  aa      d  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :   *  .:. **  ****: .:. *...:.    ..   *                :   :: **      *
qktaytsf-tsVmdelfsDG-vNWGRivslfaFggvlcvhlvekg-rSp-----------lvdriaewmttYLltqqrdW
pdsddmglvwn avsvvr  tt    vagfvt aatvaqeckssegm hgpdpgrqqepvccrlvsreisv  denldp 
rtdlrqr  kk vn m k  hf     ia  e   a  rq qqqq   s           s pnlvdt ai  nkpkks 
 a  ch   ee    g                     d a  n   e           q ge      e  eghig  
         aa                                                           d         
                                                                                

       250       260       270       280       290       300       310
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: .:..*: * :        :       ::     :.      :                          
lqsnggWdgFvel-ygedtestvrrtqmafvgvagvgaglatlir-g-----k-----------------
iakqns er anffkvrraaaqssnyleslktwlllamaglfsflv-vyfaq-rqdcswaftspptfpgl
vre   c ckyahdqqk  ig sswttinn f i isvvagltnvsllvkigl               
  d     a   i f gng  ef cmkp   k      l   f ilsikisf                  
                a    ad  f     a          a  irai                     
                                             a                        
© 1998-2019