Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :                                                           
------mfglvrnlvidynly--------c------------------l---g---------------a--g--------
mmmadgesqynleaavgllehklrqkgyv-ggaglaagsggasssggr-vav-yewtarrevgggeag-vi-gsagaspp
 ahtgatryskitinr-fts          a                k sqk ksasrfsd eenrte pe tesemetf
  afprsgpdtaq ltk---                               t    dq    a daga  p aapapgi 
     llanr  g  m  vh                               r                            
      k ea  a  l  ig                                                            
               a                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------p-------p----a---------------------------------------------------------
stlagntpa-darrvar-svig-egpdvtatppkllpfaavrcasppekmegpaadaimspeeeldgyepeplgkrpavl
aain r    swhlads apnp tahsssldarevifmpptkql    e                               
 sqp      artsppp p a  a aaaa ag a s v   vh                                     
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      .:.  .  . 
--------------------------------------------------------plggsgaasrkaletLrrvgdgvq
pllelvgeassgpgtdgslpstpppaeeeedelfrqsleiisrylreqatgakdak-g------------vmqeaafefe
                                                      vlq-pqprshpsrvsqa  dl asis
                                                      rea spe tpatplha     q r
                                                            a p  d ea      d  
                                                                              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            *                                   
rrhe---tafqgmlsklhitp-gtavqsfsqvmvelfsdGv--nWGriVtlfsFggflckelvs----------------
lnyrrflrklsdltrqfdvknvendrkrlhr-vehvprrpptls ----afia-eaavavhskqerylnltpdqqqelew
gevq   ktykpc-d-----s d--yti-e-l-nkelen ii r  hv -i-- --i-i-k-lngt              
t f    sd reyv-gv lv- -sr---vat s--  qg qr     l  -lv a -m-e-p-d                
q         a wsc     r f  qgl -  eqd  c              t   v lar p-                
             aa           e  t   d                  e   t      p                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .              *:                                                     
-inmeslveplaewmteylvrhlrdWivkngGWdgfvelyg-e-l-----------------rnvllgflvvagvglgla
ekeqqvcisrvsysiadvitktkgp lqqqr---t--vffhv-d-eesrkgqerfnsswlsl----taaag-gvivaksl
 -vpdpdafkivafvwtf-ndrtee fre--  h-vt----npaaaggirlrplswggv   kwlw-----a---l----
 t-vsa cqqfqtllvs- ----ht  --sd  esgqlrkspnm p a     gndf i    tf vtmtlstft-tvvy
 r hgq  gn crcccnr et has  hsh   an fa  fes             a      sg sq velccltniii
     k  dh  l   a   g   a  ed     e c    dg                    r   l  ag aksm g 
        ag                  a     a                            a           ic a 

       
....:..
       
ylir---
f--kryy
-sr-nll
sfwsk  
lgl    
  h    
  a    
© 1998-2019