Dataset for protein Bcl-xL of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************.******************************************************
MSQSNRELVVDFLSYKLSQKGYSWSrFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
                         q                                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
*******:***************************************** ***********************
VLVSRIAtWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERsNRWFLTGMTVAGVVLLGSLFSRK
       a                                         f                       
© 1998-2019