Dataset for protein Bfl1 of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKFHVVSVDTARTIFHQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************** .  *                
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWhsvqV----------------
                                                           engf rkfepksgwltflevt

       170    
....:....|....
              
--------------
gkickvlsllknyy
© 1998-2019