Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          ..  :        *                                     :  
-----------------------msysnrelvyfyitykLsqrnyswskmdlegasgrtege------evtpt--pvlgs
mnlsksltratttmlnvqnmvvgsl-dgapicvyspngp lpagsvkcflevdlgnrtndtpvrptklmasmpkpnsvdn
                   gane-- nskv  enf yh  cknafpcnet-ttnqfdnavfs      dpnannsgg vr
                     ddnt    f  ak  cd       aiehqga eed a n g       ieev  ae tm
                        p                      d e                          a fa
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         . . *                              :   **:  .  :  :      :: :  :    *  
rrnsrrnlgkpstPqt------p----sh-------------qavkraLRdsadefelrytrafsdlssqlhitpatAyh
glsgladdsddnl cgplmvtq-saglpmcpsgnevldndtrelihnv  eytnlsqrmwqqnkllvtmkrvvgdvi kr
hpldtskatsggv tqsswpsecdrtvcl             arleal   agg l pl kpd aeh  yl ssv hq
 ihqppag q  d hiqnrlps r   g              d   e        i    al      g         eg
    am   e     fakpi                                                            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :                       * ..:* ** .****: .:. **..:.    :      *  :   :: **    .
sf---------------------tsVmdelFrDG-vNWGRivglfaFGgalcvecvekemsplVeriadwmttYLdthiq
tyaykgmisklclddqgddmgfiee iksv s  tt    vasfvg  avvsqhlknmgktnq alvgqeise  ngpqr
r                      ra a              ia le   tm   s  rd glc nn vh   v  ledlh
                       a                          i          s  gh  g       n   
                                                                              
                                                                                

       250       260       270       280       290        
....:....|....:....|....:....|....:....|....:....|....:...
 *:  :..*: *.:::  .                                       
pWiqknggWdrFveifgrdaaa--r-sqeslktwllfg---aigvtvgal-tqk----
a lviqna eg adfyhverpsdi-r-ws--rk-f-laall-a-l-l---lm--rqwt
s  ee     a   l dqqdgenvfk spvr--v-s--vvgv-s-viqvyi-knal  
n   s            kk d  s h   fin mmga mtapt al-atmfre     
                       l c    f  l a  gm ls  f  sf a      
                                         g      l         
© 1998-2019