Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :                                             
------------------------ag-tsydnrelvvdylsyklsqkgy-w------------ap-g--------s---g
mfglkrnaviglnlycggaglmah--rmgqsthrilmkfihrvar----n-sqfsdvegnage--l-ttsvpgtp-aqp-
                     gmvtpasrsyigm aaagvqat qrr gegdagaviaedrtas etaepemeifvsins
                       mgeglfprgal  q  kk r  ee  g e     g s  g  q  lapdslr  r  
                       g dceagp  a  i   g                                       
                       a   a e          e                                       
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------sp----a-phgssgparspi-----------------------------------------
rtsaplrdvtapssrllff--tlpp-t-asgald-lev-mspeeeldgyepeplgkrpavlpllefvreassgpctdgsl
nppwhaat           a lgngsag--a---s---v                                         
pig egp               rca p vp-ea gktsa                                         
                          i qcm    ega                                          
                            e      ad                                           
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .   .. .    :            
--------------------------------------------p-rvvhqtlrqagdeferryrrafsdm----tsqlh
pstpppaeeeedelyrqsleiisrylreqatgtkdtkpmggsgaampplklamfevqndvslnnqtdlaelrgfrs--vv
                                            -saaeveva s aaqiqt lkpv qry    -rkhg
                                             atkaqdi  r   g  p he t dnf    ldh d
                                              d  la   c      k f  c  g     ga   
                                                      a                    a    
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:        :             .***: ::. : . :                   :    .         *  .    
ltpgtarqsfeqvveelfrdg-vnWGRivaffsfggalcve----svnkemsplvsriaewmaeylnrhlrtWiqsng--
isnfsdygrlat-mn---shvvps   vmtlveleavmlkrlprgtydrpvqvy-dnlstsvttvivdwthp wvesrhg
vkirm qti tr --kv qg it    la iiv a tviekalperkspnqetcklevrlfkvgfdtttked ltdqa  
 aaed vk  sd sdhq e   i         t   i aah    liridkrs ikq qy i d  rkr ge  rqc   
   da  a  n   a                 a   f          a   dg  gp      a  e n aa  hk    
          g                                            e                        
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       **                                                                       
-------GWd----------------l-g--------------nglvefr-srsgnwaslrvlltwa--------glvll
srggtap  retalgtfcyfvstfve-y-sqemfsggwtihsmgpfqqlfv--e-fptwvktvmvvclvsgvsasaviti
         q            sltapt q            g-aalnscrvy-twnrisnatgstrvtldkgvivryyv
         k            lcqr s p             stmfkk-ppslrsllfrlkp krfglgcfd glitpa
         e            e m    n             r  egaaklqdllggdqein gm  aa     efsf 
         a            a      d             l  dd  hgkaae f f  g al         dcl  
                                              a   efe      e     g          a   
                                                  d              f              

       410       420       430        
....:....|....:....|....:....|....:...
                                      
gqyl--k-------------------------------
ra-fsr-sreaeiqsqcrppcmllhlleiqvpvlflse
w-l-gsq                               
ltkypl                                
ksfqah                                
 mem                                  
                                      
                                      
© 1998-2019