Dataset for protein Bcl-xL of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************.            ::: * *:..* :   . . *.    : : . *. *  .
VLVSRIATWMATYLNDHLEPWIQENGGWk------------tlvrLyGqngAlqsrpsysrFwrwsrtpmtvrGvvLlls
                            detalgtfcyfvssfme s nga aelakgqea nadflaglgta fs agq

     
....:
 :. :
lmsrq
efplk
© 1998-2019