Dataset for protein BCL-2-like of organism Cynoglossus semilaevis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               .                                
----------------------------vngtmhygtgnstpialasslsthndsmssvtetqrrpkdlqvntanghark
mniiknnqaklnvatgvlgcfivpqngv---------------tsninrylvvkylgyklsqrny-e-h----------d
                            ldmvlmssvcltattsfvdtsqiqsffiqrfmtkst-v-t-lmlrispert-
                                 i lmp  lspmeec  keik iakh  acglwkws ag gdgdnq e
                                         gmlac   e  e   cd     gf vh         d a
                                         cl         c              e            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              ::.       .:    : 
shcevdegsepctpephseaeldvsqagdevldtdtkeli----------------erkalttmkrvvddvlekhryayn
geea-lgs---rp-t--------s-g--------------fqfyrdftthspskwg-----aairhalrgsadefelrfq
-d--t---ivs--t-lvpvvrgt-tatppdsipnrqqrsv                sstshssvhelakemgnqlqrl t
e-yvstccesrvsqpashtlqhseg-p nag  llc hpp                ape  e   a  q iek   h  s
  alnnaa qgt ah pgrcn c                a                 d   d        a     a  a
    g    n      na    a                                                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .:  :           .  *  .:. **  ****: .:. * ..:.                              
gminklslenrqgd---ltfissVakslFgDGttNWGRItslvaFGaVvcqhlkecg--------------------qen
tafsnmlrqlgltpstayvsftn mdevvr  -v    vvgift tgalsvecvvkeglkpgqepeagqelgpepgtmse
rlsrsfhqkcyvysd vqrvvrk ir      hs     iaf e     akq lqrnd                   wtq
qd qe ff  hsena  iqrlke  e       l                   aaqk                    lrp
p   d     di     chc ga                                                      c  
                  g                                                           
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .  :      **      *:  :..*: * *:              :.   .  .                        
stelvgreissYLlsyqrdWllknnsWdgFvEffrvedpeatmrn--tllglfgvaglgatlallirl------------
lvpriadwmt-  depikp iqeqgg er a lygtq--arsrsswssvktwllagatlvaavvigv-itqkvwaftvaf
tadq vq---v  nnhlqi  kt     h c isqsdgiskfsccrp mrrvvfl mswllsltvmsyfrsirl      
q at     am  ggekna  es     a     hr-eepeel qqe i kf  f  gvg gg tflwvnrfhk      
          e      d                dq ca  ai  dd f  a              asrlk g       
                                   g a                             dlk          
                                                                    ka          

         
....:....
         
---------
damflfirr
         
         
         
         
         
© 1998-2019