Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------mfrllvndylgykLyqkgy--gag-------------------------------------------
madqmmmtpcsapdtgekrqaviqln-scgq-gl---sggatppggrllatekeasarreigggpagtviggsagasppa
    lrardaefgynyr-aa-fv--v rip-avwstppdveenrtevpeg psamptpsifssqeswhtvhsp vrgavg
     ahatrvsy-i-ar--r--sd- q--arec qf     da daga   g  e  ga n n g  lpdpa snd t 
      e gntgqs- -itvkl h y - r  sp                                              
          m dpl    m   a   g c                                                  
                   e                                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
altplarrvarpppigaevpdvtatparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelv
rtssdptpevpamaa pa                                                              
hs   da a i a                                                                   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 . ..           
-----------------------------------------------------sgptsrkalqtlrrvgdgvqrrhrraf
gesnssstdgslpstpppaeeeedelyrqsleiisrylreqatgakdtqpmgre-a-p-pvhevmqkaafefetnyettl
                                                     -s-g-s-tsrawkalspseevnknw
                                                     ppsaadvl--m  s  arlrqlf sr 
                                                     l rv t -kl   q   d  lgl  f 
                                                        p p eaa   e      k    d 
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             .    *                                             
spmlsqlhvtp-gtavqsftqvmeelfsdGv--nWGRiVaffsFggalck--------------esvnkemeplvd---r
qglvrnv-iksiesdrtrlsr-vnkvprgspgtt --l-tliv-eaivivreplvtawwkkrsfklltqrqqvdistykq
kdcadk-n-an dd-yki-n-msihelqr i ir   - -i-a --f-aa              h-kriniascag   p
reyta-mdt-- --rq--vet -d-  e  - v    v s-v- a -m--              -p-d--hsk  e   e
aawsps aly  fn -gl al a-a  c    r         t   v le              q r-r   g  a   n
  p gg   h      e  -            p         e   t                    l           g
    c                                                                           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   *:                                                           
iaewmaeylnrrl----rdWiqsngGWd-fvelyg-na-e----------------------------------------
vsysvvavivthtagqhgp lvqqr--eg------ve-l-esrkgqkrlqrwvltqmtmspppgnagpvimsieekmead
lqtfittf-mntk    ee frks-  -tetiffrn-daakkfepleefnnepekgfs                      
fcrrlwd- edn-    at  he-   gl chkahtsmpv ea kk      f fd n                      
d qcc sl ---     hs  --    ae aa   prgml                                        
  l      ss       a   d     a      dpff                                         
                      a             ke                                          
                                    g                                           
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------wrnvll----vagvvtlgaylsr------------------------------
arsiyvgnvdygataeerrlrfhnwgg------afallgelgaglslfi-kllesvrtslaldeslfrgrqikvipkrtn
                aleaheggcasvntwtivavk-castlvfkqy-tsdk                           
                         wrimrtmtttmgi-lmssqkgkkwsr                             
                         slslklfpslgtfv ipnhi fimhl                             
                         effh h eqgfaas hlka    gf                              
                              f  mcd    ci      ea                              
                                 l              c                               
                                 g              a                               

       490       500       510       520       530      
....:....|....:....|....:....|....:....|....:....|....:.
                                                        
--------------------------------------------------------
rpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                        
                                                        
                                                        
                                                        
                                                        
                                                        
                                                        
© 1998-2019