Dataset for protein BCL-2-like of organism Chlorocebus sabaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 * :  .                                         
-----------------------madpatgydnR-lvad-----------------------------------------
mfglkrnaviglnlycggaglgm---g-sspty eiavkkeasarreigggeagtviggsagasppaaltpdarrvarpp
                      agtt-rrprst l lte                                         
                       asgclmeqig a  q                                          
                        ha efa ge    m                                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :                                                               
---------------ylgyklsq-gy-w-------------------------------------------------gpt
pigaevpdvtatparfvs-----r--vcsqmsdveedaimspeeeldgyepeplgkrpavlpllelvgevgnststeasq
               liqfvptrkaas-eefeapaanr                             tdspegspsd-rl
                 h a ri   pl                                         a aa egameg
                 f   q    e                                                   ae
                          c                                                    a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.                                                 .   .   .       :            
Pgtppsrps-------------------------------------rvvhqtlrsagdeferryrrafsdmlsqlhitpg
 s--epqtgwhtvlyrasrgpvsrysslqatgapptaamsrsspvs-plqlvmsrvqkrvstnhkttlqnltv----ynf
  sisgpeeeelphspqvneitghtlreptrevkdmkpgpalgatpt-elkaa q aaglrqllesf dgysrk dvsie
  ign naa  dedpa  ldaia s p d pa iaa          pkake   e   d ql f pd aevng   lk d
  af  k                                       d  aa   a      k    c  a aa   a   
      a                                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .  :    : .    .***:*::. * . :                                      :.  :  
tavqsfaqvveelfsd--gvnWGRiVaffsFggalc-esv--emepl-------------------vyriaewmvaylnt
srrtrvttmmdkvlrggpvpt   v tlvv eavvlv---nk-----mtawwkkqslrqrleqevdtsqvqsylttvfvr
ndykllsr svhe q s it    l siit a tmikhlktrnrsvc       klfqp iapdg igpliqsiael ss
d qg  nl ana  e    i         e   i aa   di qqs                     eneclrf de id
   e                       a   f                                 dkd a      
                                                                   a            

       330       340       350       360       370       380       390 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
        *:  . **   *   :                        .*                     
rlag----WiqsngGWd-gFvelygp----------------w---rtvLtga-lvggvvtlgaylwrk--
hntdqhra lvqqr  ent tkffrvsaleesrkgrplfnss-lsvmwl svtvtlcallsvlsqfs--ll
tkrte     rks   a e chk hsnmaaggi  qrrrlgn a lknf lqmgkialmilgfklyitr  
n hp      he      a  a  engd   a    efpkfg     k  ilffga ecgaa gf gs   
  e        d             de            eaf        ea aa    a      ch   
           a                           d                          a    
© 1998-2019