Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-m---------r-lv-dylqyvlqq---------------gagpgagpgka-----------------------------
m-tdpefgyiy-e--q---g-k--ingyiwlnlydveecg-pql-s-ssg-tppgirssqpgwhtvkppavsgatsrtss
 aatcasapdt amaalfvmf-is-kavsgsqfs    vct---e-te--pst sginlntsaklthsmgsrdpvghs p
  hagrtsrtn  ilvkkr-ag rrrl e         nrarvgatp-pvmpd  aflga    dpd a rn   a k  
     lreqse   fm  is   kl             da ee  g   r ea                           
      m        g   n   g                 da  e   p d                            
                   h                             e a                            
                                                 a                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .                                                   
---------------------tsrvlraagdevqkrvernfspllsqlhvtp-gtarqlfnqvmeelfrdg--vnwgriv
lptrevppmaagpalspvppvvhqamqkvafsfsaeyrktlkecgdnvngasidssyts----v-ke-e--pip------
 dapaaiaa            pggtwlrtek-aetnrniggrdmatvigisa farvprvttm-n--l-gs git   l 
                     l--r ks  -r--rgl tawgsavasyrtyr endqk-ler sdhv s   v-    v 
                     -llm  q  lgp l f qrhqgptrkmdlkn  d pg  al ava  q    t      
                     eke   e   d    h  l a fspa a h      e  s                   
                     aaa               d    f                                   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      . :                                                                       
affsfggalck--------------esrnkemeplvgriaywmaeylnnrlgd---------------------------
ti-a-eaivivreplvtawwkkkllrqviapdvdtyke-sefvvafimtntaevtatparllffaptrraapleemeapa
--v- - vmtp           rgfdakrvarqvpis-v---------rhvppwihssggwele ika vrem     ek
sliv a t la              qp drnqpsd eqlqaslttv edeketqh                         
   t   f ae              hl ti  sgc dpdcqri dl vat rg                           
   e                        l       an  l      ss  h                            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
adaimspeeeldgyepeplgkrpavlpllekmeadarsilvgesgnspstdeleahfhgcgsvnrvtilcdkfgslpstp
lkelqnev kqmnms p gnag vimsie          y  nvdygatae                      sgh kgf
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetarffqgwvsrvdiknedd
ayi fsdk sv t  aldeslf grqikvipkrtnrpgis tdrgfpra yrarttny ssrs  ys mnrkp       
                                                                    flcgl       
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              *                 
--------------------------------------------------------------Wiqqnggwdg-fvelyg-
vkslsrvmvhvpsrgvtrwgrivtlisfgafvakhlktinrqscyrgrarsiwsvlvrtkrs lrkq-----g----f-p
          lfcd prn                      qgrvieplcecctd      td yve-r  et  tkf-hv
                                        hek aa c  a          a f--y   gn  chklen
                                                                sss   ak   a  rs
                                                                hp     e       d
                                                                 d     a        
                                                                 a              

       490       500       510       520      
....:....|....:....|....:....|....:....|....:.
                                              
----------------------llt-m-vagvvtlgayl-rk----
naleesrkgrerfnfwwsvrtvw--vat----ilemslfsk-ycal
edaaggi  qpplgrsalsksg-mag-lmtalgcglls-l-qlm  
sm   a   plledn    lnwftsflglglk-a----hitrkl  
g         f  a      rt iqaveac is-vsvf ws     
                    kl hnlfp   clvkiga rh     
                        gh a    anaf   g      
                                       a      
© 1998-2019