Dataset for protein Bcl-2 of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************** **********************:************************
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAgAAGAAPPGAAPAPGILSSQPGRtPAPSRTSPPPPPAAAAGPAPSPVP
                                r                      a                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************************************:*************
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVmCVESVNREMSPLV
                                                                  i             

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
*********************************************************************
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                                                                     
© 1998-2019