Dataset for protein Mcl-1 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********  :**************************.****************************************
MFGLKRNAVIglnLYCGGAGLGAGSGGASSSGGRLLASGkEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
          rtq                          r                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************************.**************************
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLrRVGDGVQRNHETAFQGMLRKLDIKNE
                                                     q                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************************  : *:
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG--fvEf
                                                                          gvwg w

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .**:*  *:                                                              :*: **
fhveDLeGgiRn--------------------------------------------------------------vLlaFA
stps  k es keccpswaaeagrwgadlslqtvaqwlspllsacrnssappssplgivyrtawatqhtlflkmi iw  

       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
 :                                                   :*:.*** :::   
gv---------------------------------------------------aGvgAGLaylir--
llpprgprwpreawvttcgtptprsgpeapweflslpatqlflpfltklllehs is   khfvakr
© 1998-2019