Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .    *                *               
----------------------a--g-tsysnrelvmkyihyklsqrGyewdageviaappgaaP---------------
mfglkrnaviglnlycggaglm-gs-ragsdggrilasgkeattrre ggge--aagggsatqs pttlapdarrvarps
          rtq        gmhapg----------df--m dcek  v--vf-d----vlei                
                       qt asaq t a  v--vs     f  tlsqas-yvrnr  g                
                       a   m p         rg        s al q veehl                   
                                       l              d d   c                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .                      
------------ppgislsqpp----p----------a--sp-----------lspvppvvhl-----------------
pigaegpnvsatagrll-la--cras-peemegpaad-im--eeeldgyepep-gkraarlp-lelvgeassgpgmdgsl
            tet--s--xxsapxxaxxxppadsaxxxxaxxxxxxxxgpxx- a spksr                 
            q  efamxtgxxxtgxvtwhl ppp vtgxtrpsvsttxxtvi m d aqq                 
            g    efe ernin nrss    m  rna lghisdldarep                          
            e            a  phr       pa  aaaaaaaa  a                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   .:. ..  .. .    :     .: :   
---------------------------------------------------tLrraGDdfsrryrraFaemssqLhltpf
pstpppaeeeedelyrqsleiisrylreqatgakdakplggsraasrkaleamqqvafgvqtnhet-lqgllrkfdikne
                                                   v  e   e elqv kd sdctds  vvsg
                                                      d   s  g f  t kp aa      v
                                                      a           n             
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  *    * .*  ****:*:.: * . :     .   .  :    :   :.  :      *: .. **     
-targrfatVveelFrDGV-NWGRIVaffsFGgvmcvesvnremsplvd--nialwmteyLnrhlrdWiqdngGWdg--f
dddvkslsr ivhv sg pt    l tlie eafvakhlksinqescieaeplsesiadvivttkht lvkqr  -agv-
 s yqi tq snke q   i       v v   altak lekriqvd s  rvqyfvvtf tdrmep  rss   e-  w
   qt   md   e             a   i      dq      g  q  a    e n a   h   at   
                                                 k                      n   
                                                                            e   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
velygptm---------------------------------------------------------------------all
--ffhvedleggirnqplfdfswlslrwgadlslqtvaqwlspllsacrnssappssplgivyrtawatqhtlflkmv--
tk-----aakesskkrrrrswnaeavk                                                  -wi
gawstns- a er geecpnga a g                                                   wv 
  k edns   a    c  e                                                         tf 
      k                                                                      i  
      g                                                                      g  

       410       420       430       440       450       460       470 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
                                                                       
tfal----------------------------------------------------vgacitlgaylg-k-
sl-gvpprgprwpreawvttcgtptprsgpeapweflslpatqlflpfltklllehl-vvag-aylirh-y
agm-l                                                   aa-gv-v-sffasy 
--lva                                                   - t--lmw----rr 
w  t                                                    s isce khhvsq  
   e                                                      gl       kk  
                                                                       
© 1998-2019