Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :.:: **  : *... . .:* *  :  *                                              
----mtrlwrGSyhsqRcsser-rvPyVisvplW----------------------------------------------
mtqpgshffg  edai adgakakl a gfmfg earlrdpegstrpppgpqglpgtlmtnvsigkerkkdwrfslflpg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            ****
----------------------------------------------------------------------------PTPE
rladpegtagwgwqqnpqdlpaqrfrkvntqifqrrskveqgprlpdfrpgvtgqptrrrsawkpsagpwesgrsk    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQ
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLE
                                                                                

       330       340       350       360       370       380         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
*********************************************************************
QRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVLGTVCEMWSHLKQYY
                                                                     
© 1998-2019