Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------mfqdtrnlvvdylgyklsq-g---------------------------------
llvlcpyinaslsslpliaarmmtds--gynheqtqafisl----k-yvwsqfsdveenrteapegtdsemetpsaingp
                    maaapass-siglirnkvvq v yig  s da g  gaappg apaegifssq ghtp a
                      h greapmfeaa aglnl n rcr  e                           cg  
                         ptryrq q  t   h   q                                    
                          lg l     m   e                                        
                                   i                                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------tgpgarsgpatspvhqalrqagdefekryrrtfsdllaqlhitp-gtarqsfsqvve
glprnpswhtapspvvngatghs--l-pgevmpspk---v--ava-svqtevekalkemssnvdvgsidnrytr----m-
aagagsvgrlsdpgrplatgacgss-d-qpsigpdatsr-mq---f--grnllaseqsctd-re-ag fsdva-vtrm-n
    d gaa p g pla pa kdakttt-  g ma-lklt  e  ag sllf tf agaark--lyn ee qkilet sd
                     aare mls  a a- ele   r   d rg h sd  ay g    k   d ggl a  av
                       c   gp    vt aaa                                 e       
                                  r                                             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  . .  *                .:*    : . :                          :         :       
elfrd--G-----------p-nwgRiVaffsfggalcv--------------esvnkemeplVd---riaewmaeylntr
--vtgsp sagasppaaltvidarnv tppaieaiv-krgplvtarwkkwgf-l------vdittykqvssrlvafiprh
kels               itt   l rllv a emi-              k-lreriqsc s   etqhfvttvamnn
hv q                       miip   v la              q rdrnqag  g   alpasilfl edt
 e                          e   t ae              h kti ps   e   pdcq   d  vs 
                                  f                    l       a   n  l      s  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :    .                               :                                  
lad----wiqenggwda-fvelygeeeleesr----gkrrfvlwlltlvt------------------------------
tgpqhraplesseapatg-ai--pvna-w---plpl-rppenrsfmegmgepangsstdgslpstpppaeeeedelyrqs
ree      rqqr  es d--ms-pgdadgyekevtvqiaamkpwfaq--p g agpv   im ieekm adarsi vgn
kva      hkm   vn etkkfrn--tartlrkrkesenwlflv smyv                              
 rt      vd    gl   afak-ssm-mefm meanwlsketq qdsp                              
 hg       a     k      hdrmgghdal l  lvcqd rk n ll                              
                g      e k    a h g  gq n  ka k kc                              
                e               e               aa                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------ilg--l-----------------------------vg-lf-rk-------------
leygataeeleahfhgcgsvnrvt-asvv-rgqatgfkdtkpmgrsgaasrkaletlrtl-s--s--hetafqgwltqvd
vd                      v--ryfvehpp apymvvsssisvrtstimrasvr-sdgvqinlkafiyssvrkl 
                        liclmessagk  aviefndkehllldl  dsflsr aylpsrf      m cg  
                        gv ik k                        eckff rqylhq             
                        a  d                             i a pfikad             
                                                             la g               
                                                                a               

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
iknedivkstsrvmvsvtsrgvtrwryrvtttsynssvsrhystinsrscirvyrgsitdvlvrtkrdwlvrsrswygpy
     dp rln pgihtpdd prnagriarlinfgafrakflkgf qqprgeplcerc             kqtg vsiv
                lfc  fp                       hek aagfa ca              a   d fs
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510    
....:....|....:....|....:....|....
                                  
----------------------------------
nkihvedleggirnvllafagvagvgaglaylir
effal                             
                                  
                                  
                                  
                                  
                                  
© 1998-2019