Dataset for protein Bcl-w of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     ***********************************************************
---------------------MATPASAPDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAAGDEFETRFRR
llvlcpyinaslsslpliaar                                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****  *          *** .*.*               ** ..*            *:: .* *  ** .       
SSGGWe-EftklyvrgmlEEArrLrE---------------GNwgsV------------RtvyvGnVdyGAtvt------
     al aiaargdeae   ek k lqnevekqmnmsppp  aap imsieekmeada silt a al  laeeleahf

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikidfkafiyssltqvipkrtnrpgisttdr

       330       340       350       360       
....:....|....:....|....:....|....:....|....:..
                                       . ::::. 
---------------------------------------vtswyssy
gfpraryrarttnynssrsrfysgfnsrprgrvyrgraragaffapk
© 1998-2019