Dataset for protein Bfl1 of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :           * ::: :
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWgn-----------Wmtlmlv
                                                            ekgfvkkfepksg hsflem

       170     
....:....|....:
  .:.:    :    
tvsvcqmlslmkq--
lgkiaekkrklalyc
© 1998-2019