Dataset for protein Mcl-1 of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycggaglgqgsgasspggrllaagkeatarrevgggeagtviggsagpsppatlapdarrvarpsp

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             * *
-----------------------------------------------------------------------------GsL
igaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrpavrplpllvgeasnnspgsd m 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*     :********.*******.***********.*******:*********.*******.**********.*******
Pst---sEEEEDELYwQSLEIISrYLREQATGAKDvKPLGGSGtTSRKALETLrRVGDGVQrNHETAFQGMLrKLDIKNE
 ifpppa        r       q           a       a         h       h          q       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************** ********************:******************************:***********
DDVKSLSRVMVHVFSDrVTNWGRIVTLISFGAFVAKHlKSINQESCIEPLAESITDVLVRSKRDWIVKqRGWDGFVEFFH
                g                    f                              e           

       330       340       350
....:....|....:....|....:....|
******************************
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                              
© 1998-2019