Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycggaglgqgsgasspggrllaagkeatarrevgggeagtviggsagpsppatlapdarrvarpsp
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
igaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrpavrplpllvgeasnnspgsdgvm
                                                                              sl
                                                                               a
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   . :                                                          
-----msqdnre----lvmdylsyklrqkgy-------------------------------------------------
mhtpataestedlvyr--vkfihfyaseratswsqfsdveenrteapegtpsdapapsiisgnpswhlapsptvngatgh
aaaggsvyeefaelhwqsleivgrc q-q--ga        dagd gaapegamet galnsqagrtptderaspppvpa
tsqespgptfarytagila   eqv   p  e                   vrygn qw            a  lkdpkp
pml pltdr  gr    ae   k     -                      tp                      rhaa 
ggg if  p                                                                       
de                                                                              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .                             :           .**.:.::. * .
srgsgarsvpp-avlhq--r-agdeferryrrafsdllsqlhitpgtavqs-feqvvnelf-rdg-vnWGRivaffsFgg
vgsappperkamptvkral-ev---vqlnhettrqemtakydvknfddykrilarmmehv-dsgrvps  hvatlvv aa
lcqgdttppitaep-rltm q-ssglstefqqdnagvsrrmrl--es-re- -ttlsdr-l qppitk   l siit s 
aaapasgngvelda --   a and yh v ehlvqcaqlfa-vs--tq-t vs  lvke  e  g          e e 
--pl nkktl s-- qh       s kd i    rn vp   rcrvhr-rl  q  iq    d             a   
rq e    s   t   d         aa c    k  md      r  cg   n  a                       
ii      m   r                                   a                               
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :                                                     *:  . **        :        
alcv--------------esvnkemeplvdq---------iaewmatylnrhlrdWiqengGW-----d-gFvelygv-a
vvlkrppqttrrqekrddklksrnqsvcissdgvsrdcrlvqtsitevietrkhp lvssr  vsakdantltaffh-n-
smae              hppditirskrgr       kdlvllvvaffves-et  mkq        e e clslengd
f ta              rglqtdrqqdmep         -tfftcdqctdntaa  hde          a  kk stet
t  m              dfig cchl  --          sa l q  cn hke  kt              g   ssh
i                        a    m             c        g    q                  raf
                              d                           a                  q  
                                                                             d  

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------es----egfwrwvltallgva--galvtlgayfsik---------------
lagwilsllqplipailgktaglvfplil--rrgqfrgnwssrlvfttlvlv-gci--kslylsrpsrptqskpssryft
ae                           pamkprqdnsanfvkg-msayglet--lv-lflgr-llncnlehlpgetal
tn                           d qnlllssillq vwtalisataivlrisqaaahqce             
                               n hnkpldkti striw fw   if   nq --                
                                    l  er  eskgk c     c   ii wl                
                                       ci     f            h  tk                
                                                              k                 

    
....
    
----
slfm
la  
    
    
    
    
    
© 1998-2019