Dataset for protein Bcl-2 of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************* ******************************************
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARgRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
                                     e                                          

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
*********************************************************************
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                                                                     
© 1998-2019