Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------r-l--d---y-l-----------------------------gpg--s
mpllvrnpyihlslsslpliaarmatpasfpdt-a-va-ylm-k-qqkgyvglnfsdvgenrtgappalycgga---age
 fg qlcav gan ycggaglgmgmggctagynhnitqnfvgfggrrpavicsa g  eaappe aegtgsewtklmtr-
            h         aasddrmsytive rvklir v sinplswgq              pdiksstasgqp
                        ha leqrsq v atga s c a r gprdt                afmeq  ptn
                            rpqgg l  m   h        ek l                  dce  hp 
                             g fe    l   e                                    i 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g--------------------------------pa--p--qalraagdevegrlrrtfsellaqlhitpgdavqsf-qvv
-paaprnpvwrtspsppvngptghstspdlspv--ts-lh-----v---fqtnyekalkdmss-rdvknktn-kr-t---
s     d sshladp apaaaaaaasglaare gpapkvssvmqk-afs-grmfla-e-paa-nve-ggisdq--lsrqs
e                                tgsdatlrtsntmltgspklv ts-q---rm-nnvseeryrmifsmm
                                 atpt aaeyn rkirtq--eh swrpgctdk -ly fn aglvet a
                                 i vr sqmwk qgcepcsl i mf aaypg         re  a   
                                   na nklc  p  ad r     d   v               y   
                                   m  e a   l     k                             
                                            g                                   
                                            e                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            .  . :                                                              
velfsd--gtnwgrivalfsfgaalck--------------esvtkemeplvep---------iaewmvfylvtrlad--
ghvirgdgvpgasplatfivdagfvavrgplvtarwkkwgfhlkninqvsdigrlaesirykevqyrvtafaprtrraqh
dakeqespsat  np mivp err-va              ppprgriqvc-dq       srlssslaevinnhkgp  
n---g-g iv    v   ta   imir              k-lieaea-- tt         tpgfildlredntee  
mv lf    i    s   se   - --              - -d----g  sa         wca cwt  msd --  
e   -    -        l    v le              q r-r ps   -n         sdq  e   se  vt  
-                      t                    l       ag         d l          hg  
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .                                                                       
--wieenggwda--------------------------------------------------------------------
raplvsqrapagdaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgslpstpppaeeeedelyrqsleygat
  --qkse iete  karvr mereaeklkelqne ekqmnmspp   dgpv   im ieekm adarsi vtnvd    
    hqm   vn           e                   e    a                       g       
    s-e   re                                                                    
    -d     s                                                                    
     a     l                                                                    
           k                                                                    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                :                               
------------------fvelyg-e---g--------------vrlaltgvagvgag----------------------
aeeleahfhgcgsvnrvti-----v-ale-ardtrprferswassltvfatlrvlld-vqylietafqgwvtsvdikned
                  -isrflrgqateskrnklmvdgngra-wklmelalraivllarnhrrfyyvvlrqs      
                  mtafkhnndpa gikgqfvkgfeivwlswt lesva-aceslvsrkqypvss nkl      
                   rcd fdsm r tayigss nkgslrgkms scmt-r tqmktqlpgkmamm cg       
                   l    s h k f   eel k fpknt hg qv -lk rmivsdk a i l           
                        p         a   a  ng f  f dd gfg lde fag                 
                                                        i   a f                 
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
dvkslsrvmvhlpcrgprrwgrivtlisfgafvakhlktiniqvtlggffrsktdyrvrttrywsvrsrswfgfvsrprv
           vfsdtvtpg                     hslcvaalcacc  vla  kndnlskq gys isnkihl
           i k rn n                      qhklastipsrr                f d  neffag
                                          etairsylihi                           
                                           s dep igaf                           
                                           i  dl he                             
                                                 a                              
                                                                                
                                                                                

       490       500       510 
....:....|....:....|....:....|.
                               
-------------------------------
rvyrgrirnvswyspyvagvgaglalslihi
edle ga atllafag               
                               
                               
                               
                               
                               
                               
                               
© 1998-2019