Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *********************************************************
-------------lsslpliaarMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
mpllvlcpyihas----------                                                         
            h                                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******  *          *** .*.*               ** ..*            *:: .* *  ** .     
IHSSGGWa-EftalygdgalEEArrLrE---------------GNwasV------------RtvltGaValGAlvt----
       el aikarvreme   ek k lqnevekqmnmsppp  agp imsieekmeada siyv n dy  taeelea
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdfkafiyssltqvipkrtnrpgistt
                                                                                

       330       340       350       360         
....:....|....:....|....:....|....:....|....:....
                                         . ::::. 
-----------------------------------------vgaffask
drgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                 
© 1998-2019