Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :   :                      . .                 .                 
----msqnrelvvfyitykl-------------------sqrnyplnhlgln----------etp---dggesggseeqr
mlpssrtamk-aeggmsclmflleaesadlpqngvveysvgvgsaqstmsssidacngnaaldr-nrt----dnlyatrp
 eemgns---i-tkflmwg          kcadaegklr k  h ailrrpd          kqtknlgvss-c vgdkn
  ma---  n  m q ch                      h    wgvhmcr           e dia rkmn  lwvpt
    nec                                      saf daq                 daa     kd 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   ::.   .:  .: 
iathangtfngrspgtp---------------------------------psspl---rlpptksldavkralrdsanef
nsaasddlpvsstgplgelmsdsevdvsscpagdevlendtrqllsqflqdap--rqq--csstemstmrevvnevldkh
pglnvryiedcclsews                                 nfigqtkp w ecephe lhtlaq mgeql
lp le rcsla   cd                                  ap   hcr     d aa        aek  
        re                                                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :      :  :      :    :  * :.:. **  ****: .:. * ..:.    .:                   
elryarafsdlsnqlhvtpatayqsfenVmdelfrDG-vNWGRivglfaFggalcvecvekemsq---------------
rylftqminkmhsddkiddvs---fits aqsvvs  tt    vasfvt tavvaqhlksqnrenpgldlgkgqelgqep
qva nglattfll cdp sd  qrrlka ie   k  hm     ia  e   t  rqml  heme               
 r  qsd qe  r  yl  t      rk      g                       a  kdkt               
    hp      k  g   c      ae                                    k               

       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
     :.: :: **      *:  :..*: * .:    .  :    .  ::      .      :           
-lvgriaewmtvYLdnhiqpWiqsqggWdrFaelfg-hdaaaegrrsqesfkrwllagmtlvtgvvvgsliaqkr-
gqcslvvqeiss  leaqsd lvrnns eg vkf-rvqspestvvkqrsalrklagvaav-allislvvyt-l--l
 c dnl dt am  nsplrs  le   c cdiy- aqrs vass lm magvffi vsglasllscrvqpklvr
   rg      e  ggekk    d     a     d -  rf c  i ta  l -- -   tiag mf-hlh
   n       d      h                  r     e             l     ga a l     
© 1998-2019