Dataset for protein BCL-2-like of organism Amphiprion percula

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :                                      :     .   .             
m-msqnrelvvfyinyklsqrnyvl-------------------------gnvvsseapsrtdgsga-------trthsn
-nsiptttkrtafmk-lifpqygpvegpmhygsgdsspqiavassidshnnhmgpndtekppknlevrlyesqrleqdad
 snyswkntle----h- akdglsw                         sllslrqedpansegv nggaekn------
 mcgl   i  k vs    e    t                         cfdrvh   g  n dk dppptlvrscsea
 a ec         c                                    cad e   a     a        n a   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              :     ::   .   *  :               :  *:::         
st--gsspgtpp---rrl-----mpavkealrdtarelerryqrdFtdlssq-lritpstayssfkrVmde---------
gmfn-tl-c---pss---tsvstcd-gd-lmendtnqflllflqa sgmhkpf-hwneakllqtmen vedvldkhryay
--een--n-sdelqpdseadtas-- --sv kragddm kqhapr hs trt  yqcstd qrrlrs i           
 llv prge   hlc   pqsdpie ihr   el q      ta   e  q   dl gp  ch  ak             
      d                ha                                 e       e             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         :. *   ****: .:. * ..:.     .      :                 : 
-------------------------lfrDg-vNWGRivslfaFggvlcvecvek-emsplvd---------------ria
ngminklslddrgddvsfvsavaksvva rtt    vtgfvt taavaqylkdrkgrenclgpgkqqelgqgpvncrlvv
                           k  hl     ia  e   t  rq laqenttsq p               nls
                           g             c         a   d keg                 e  
                                                                                

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
: :: **      *: .:..*: * ::                :     :       :           
ewmtvYLdshirdWiqsnggWegFveifg-qdaalevrnsqmsfkkwllvgatlatgvv-g-liaqk--
qeist  lneqqs lvkqns dr akf-rva-peatssktlealagfaglfmvvvlllrv-s-----rl
dt am  neplsp  le   c c ly- -q-ssva rvwqtistvtaiaglglvsitilvyltvrq 
    e  gg kn    d     a     d rnrd sf e spd  rkf    aagm  lg tf lk   
    d      k                          c rd   m         a  aa a       
© 1998-2019