Dataset for protein Mcl-1 of organism Amphilophus citrinellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 : **:       .: :  *  *.        
----------------------------------------------tspdsNGtpkrpnnlgvvstnGyaPknitddved
mntctmrncrmgsyknvmdlflpqngvvdgtmpygsgnsspqdatg-pker  s-------aistql lh r--------
                              slhf             m                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                  .*************
gslpstpefhsdsesdealeretkslitsffrdftglsqrrwkesealktmkrvvadvlekhryaynGMVNKLSLDERGE
-----------------------------------------------------------------is             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRV
                                                                                
                                                                                

       250       260         
....:....|....:....|....:....
*****************************
ADPESTVRNTLMAFAGFAGIGATLALLIR
                             
                             
© 1998-2019