Dataset for protein BCL-2-like of organism Acanthochromis polyacanthus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfrrhvkasyyvigrqgradvggymnmiptkrttlmnclifpqngvvegpmhygsgdsspqisvassidpqfvsvlagpe
                        vrahtlvn kw cdilveldsflca sdrrt   vterrt  resra         
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       .: :     
------------------------------------------------------------------n--qnrelvvfyir
lvcngnlgssdtpkrpknlgvngyapkslrqdsdsmedgslpctpelqsdsetdvsscptgdellm-msdtkqtirrflk
   qpcv lvf  e  vdisgpww         eqraa rq g vcvh naarrtratr ent aessgsw ni ela--
                                                                 rmnel      k  s
                                                                  accc         c
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     .:    :.   
-kls-r-y---------------g-------d-------ngtftgt-pg----s-rrl--s--msavkrvlrdvadefel
y---q-n-plnhmvlneapnrtd-gearlge-qrtsthc--dsnnps--tppp-p---ns-ktldtm-eavdrtlnkhry
h   k g vwsllrvrdeggann   svvdpppylersaheplvalrnpseshlkp waetaa----hstmkeagqdm r
         mgfddpe  da           ektsvlrsa lhq npde d a c   pq dpie i a    l   l k
                                da  ac   a    d                ha               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .        : .:   .           :             ****: .:. * ..:.     .      :        
syqr-----sfsdlssqlsitpatay-ssfanvmdevfrdg-vNWGRivslfaFggvlcvecvek-emsplvd-------
rhngminklaldsihddvhfvstvdkcqlled-------rtht    vtgfvt taavaqylkarkgrenclgpgkrqel
lfaq     t temgraiyrqtgp q rr rs ie lvk   l     ia  e   t  rq l qenttsq p       
q tp     r h  tq fll ce  f h  km      e             c         a   d keg         
   a     d        d            e                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : : :: **      *:  :..*: * ::            :   :             :           
--------riaewmtvYLdshirdWiqknggWegFveifg-qdaalevrrsqmsfkkwllvgatlatgvvvgsliaqk--
gqrpvncrlvvqeist  lneqqs lvgqns dr akf-rva-peatssntlealagfaglfmvvvlllr----l---rl
        nlsdt am  neplsp  ls dd  c c ly- -q-ssva kawqtistvtaiaglglvsitllvy-tvtqr
        g      e  gg kn    e     a     d rnrd sf c spd  rkf a  aagm  lietkflkr  
               d      k    d                       rd   m         a  ag af ge   
                                                                      a         

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tgrgaggkrwiqggrrkpqernrrrhdacrdrgrgqgnrqnwrvprrgnqeghgagrgprrkqgdrlgrsgpdsgilqer
                                                                                
                                                                                
                                                                                
                                                                                

       490    
....:....|....
              
--------------
rtekktlvseilvt
              
              
              
              
© 1998-2019