Dataset for protein Bcl-xL of organism Acanthochromis polyacanthus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfrrhvkasyyvigrqgradvggyvrahtlvntkwmcdilveldsflcapsdrrtgdsvterrtasresrafvsvlagpe
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            ..***** *:*.********
-----------------------------------------------------------msqNRELVvFyIkYKLSQRNY
lvcqpcvglvftperpvdisgpwwseqraagrqpgtvcvhsnaarrtratrtentlarnscs     e f s        
                                                          m                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:. :  ::* .****       *: :.: :** : ..  *              ::***.:*.*:*:**** ::.:***
PlnhmvlneApnRTDGgearlgeDqrtethaNGtfngtspGtpppsprrlastatmdAVKeaLrDtAnEFELryaraFSD
 msllrped gg    ------- kassass  llvnnrd --------------ie   st k a d    lftqt   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* **: *** ***:**:.******.************.***.********:** ** **.:***:***:**. ***.**.
LhSQlhITPaTAYqSFenVMDEVFrDGVNWGRIVGLFaFGGaLCVECVEKeMSpLVgRIveWMTvYLDnHIqdWIQgQGg
 s  id   e   h  ks      k            c   v        n  e  p  ad   m   e  sp   s  d
                                                                                

       330       340       350       360        
....:....|....:....|....:....|....:....|....:...
** *******:****:***.:::*.***.* .:: **:.* ***:*. 
WErFAEIFGQdAAAEsRRSqesfKkWLLvGmtvvtGVvvGsLIAqKrl
  c       n    a   rdtl r   a gvllm  la v   k q-
                                                
© 1998-2019