Dataset for protein Bak1 of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MASGQGPGPPGKECGEPAPSSTSEEQVARDTEEVFRSYVYYRHQQEQEAEGAAAPADPEMDTLPLEPNSTMGQVGRQLAI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IGDDINRRYDSEFQTMLKHLQPTAENAYELFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLSQLTRFVAE

       170       180       190       200       210 
....:....|....:....|....:....|....:....|....:....|.
***************************************************
FMLHHCIARWIAQRGGWVAALDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
© 1998-2019