Dataset for protein Bok of organism Cyprinodon variegatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ::  ** : :: :    *.      *  .  . * .:*            : ***      * .   . .. ..     
-memlRRssvfaae---vFdrsptdkElvsqakaLcrdY------------ihSRLhragvgWskaeqnsapaggk----
mvdve  latltydvldr gefvdfp tsepvwi gke naltekdeilsdvt   ------ ftyrlgfsasnatgpts
       m  s t       e e      s                    l   nqn l    t k  i  a    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :   : :   ** :    .    *                        ::: .   ::.: .. * .
-------------laevsavvqwLGdeleylrpnvyR------------------------nvarqlnisvaiegvvSda
dtgwgcmlrcgqmvlgeaqmlrh  rdwrwiqetlq eeyisilnafidkkdsyysihqigelssselcalpmtnfh tv
             i    l clc      sa  qk                                     l       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:  *:  :..*                         **..:*   *: .:: :: :..   . :    :. *:      
FmaiAadifstGv------------------------TWgkvVslyAvagalavdcvrhghpamvhtivdcmGe------
 vvv teqmgv igkpigqwygpntvaqvlkklavfd  srl vmv mdntviieeikrlcmtwldlagesl qaevngc
 lss   aa e                              ah             q   pt  i   ae        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :.. *.  :  . * ::* :.                                              
------------fvrksLvpwlkkrgGwadItkc----------------------------------------------
legacalaeeeaalwrp tlliprkl lse neayietlkqcfmlpqslgviggkpnsahyfigyvgeeliyldphttqp
                f    l       m                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         : : . .    :: ..   *  :   :     .:                     
-------------------------vvntsppfyshwlvsavfaFghylkavvlyllrek--------------------
avepsedgqvpdetyhcqhppcrmhickmdctperpffsqvmds kywcttiyvlsmkkqglpmfelvdsqpvhmvsvda
                           el  siaag  c te d ddf lr rr ic  g                    

       410       420         
....:....|....:....|....:....
                             
-----------------------------
lnltpdfsdsdrlerffdsedeefeilsl
                             
© 1998-2019