Dataset for protein BAX-like of organism Cyprinodon variegatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :                            :          ..                  
-------------memlrrssvlale-l-------------------svfvvswiqrhllsqvp----------------
sfiqtlqdqgasy--velvctlfsaqm-rfgefedfpetsepvwilg-sydrkptdkeavgkaksrlwftyrknfppigg
maeggggcmlnpvvsqceilaty---vf                   ki nyqverd vd dtt                
        c   mtqev  g m tyntt                   de ialt k  i   sd                
            hlp      i csdn                     d    r e                        
             dd                                                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            *                      :    .  . *            *     
------------------ilqealgvtrL----------------cdpqqqkvsdvlqvvgD------------Elpslt
tgptsdtgwgcmlrcgqmatcrdyihsa hragvgwskaeqgsaaaggklaeyiqafnwla evdgyysiqrmi veyfr
                  v r q mlrh nqn l   gtdwrwsrsqknvl laaivlqii kl snmglkqlg dsasq
                    g    c e          r lnf penaare   sc  cf   k  ege hki     ik
                         a                       h        a                    e
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     . .*:  .   :. *  .    *    ::  .   :.:          :        : 
ps-------------------sdvFvkiareifsdGein----Wgrvvtvfcvagmlvvkavrskipelvktiiswiidf
ltvyrnvarqlnisvaiegvvkea mavvadlmgt -vtpigq ykpnslyaflkafaldchehghcamihmdvdcmgey
 nl          alpmtnfh t  lvs tqq av rgk      g  amay  cr  ifdtwtrlvvt ri ntvt qe
 c              l          la   a  f             q   k     liq   ti a   nsl   
                                                                    h           
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
..     *:   *            .            *    :                 .      :           
vrkkvlpWlkeqGgwe------gifsyvg------ipmWqflgvfla----------gvvttlvvvylmrek--------
fkesltg irkr eaageaevndctkcfvntsppfysh lvsvilaflrlglsdinekyylkaqylhkl-aetgviggkp
rlcvn  drk          e regackmdetptrt rtvamdsp          ahle vktmrm p--le      
  dh mh   la            m    alaceeeap  s  l i             ia tfqkki kqs        
   f i                  l          a l  p                  f     cf  ggq        
                                                                       f        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nsahyfigyvgeeliyldphttqpavepsedgqvpdetyhcqhppcrmhiceldpsiaagffcqteddfddwclrirrls
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450   
....:....|....:....|....:....|....:....|....:....|...
                                                     
-----------------------------------------------------
ckkgglpmfelvdsqpvhmvsvdalnltpdfsdsdrlerffdsedeefeilsl
                                                     
                                                     
                                                     
                                                     
© 1998-2019