Dataset for protein BAX-like of organism Crassostrea gigas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             :* :: . ***        
------------------------------------------------------------neDlqepgtPTG--------
maeskkteleihremmtllshlrenktrvrkkvpmaqtskqeikadvrkileqflkkqqlmd eedgai   fqredven

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vtetyrsgstntsweeyeclrceagcrskviksiptcsnrsptddttnftfideyehdvershkdhsesvnkrgdvvqnv

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hthkishveqhnytngnksgmlmesevweckdlagksehkhgerhsniretmrprhatsgrtssekdrlytavaeklahi

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gdhykatsplsdstrssvdntatrrasartpnlpgvdergsdgltalerqlidslrevgdsfqlklspnavkeivkqamy

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qrfqevvdkktgpgnswdhiaavfyltkkvvtmagvgravalqvkdlaaeyvadkfatwivdqggwgdlgqmaywdggsg

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          *:. . 
-------------------------------------------------------------------------pPmsyvs
trgggrvppssdvrqipspseqmtpdteenvideaedvirnfifesyqhqlveevdtldsttpqvpelcaftsd lerar

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
::** *  ***:::*.  ::::::::*  *. .: :*.* .**:.:*:* : *****..*: :**.:::..:.:      
qvGRqLrrIGDelnRr--eqiqnmvnQ--VtpstnyEvFfnVAnslFsDgv-NWGRVgcLmylAYrmtvtvvsk-----i
ei  a ac   did nyadefkdlid ln nedaah t ag  kkf a eiy     aa fcf  kiamkalkekakkfa

       570       580       590       600       610       620      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
:::. **..**.**.: :**** ..***.* ::*  :*. .* .   ***  ::. *.:: :.  .
qlmrvIVswVVrFIteyvAGWIisrGGWsAilqY--tPsnsFts---VVGsgvtviAgvyywskls
nfiks  nh  n  kdki    adq   d aie fgs qmq fglsi   lciaac alflfkakk
© 1998-2019