Dataset for protein Bak1 of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMVTLPLQPSSTMGQVGRQLAI
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************           : .:*  *                         
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIAS----------svfstGivW-------------------------
                                    rpaatptaclrlaes an grvvallgfgyrlalhvyqrgltgf

       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
          :::. . : *                *  .. ..                 
----------wmlwhsitvW----------------Pytsvsvv-----------------
lgqvtrfvvdflfhacaar iaqrggwvaalnlgng ilntlaalgvvllgqfvvrrffks
© 1998-2019