Dataset for protein BAX-like of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :: .. ** . * *..*                                          :* * 
---------------rsswrswGPsrpGmGgvS-----------------------------------------tsHvCp
vrirlvamglgevkwmaadqgp  lqe c aa plseeeqqvvrdteevfqsyvyhrhqqdrggtqgrvprahpha c f

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               **:::.   *    : .**: : :. *   * *  :*  :*..* ***.**:* :..  **:   
p--------------GDelnrrypSvyrnvlrQLqptlqseP---DlFykvAgslFspGpTWGrVVsLysvgyrLAvhvy
lsstltqvgcqlaii  dieqirg dieamaq  hisadna vvt a lai chi ka i   k  a lafaag  ldcv

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.*      *.* . **:..* .: :        *:  .***. .*. . :  *     * *.   *:  .*.::   ** 
rQ------HgLvgfLGkvvRlvvdt--------WlvrrGGWvdvLkwvvttrPs----WtVv---AlvnvGryvkrrFFv
q aqpamv a sdc  eft ktlasmlqlnvvr irek   taa dcagsfd ilhsh l ataf icmf qfliaa  k

     
....:
     
ss---
llper
© 1998-2019