Dataset for protein Bax of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   *************************************************************
-------------------MKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDSNMELQRMI
mdgsgeqprgggptsseqi                                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDG
                                                                                

       170       180       190  
....:....|....:....|....:....|..
********************************
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
                                
© 1998-2019