Dataset for protein Bax of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *:..     ********************************************************
-------------mdGsgeqprggGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIG
mshpsslgplgpksp tssllspl                                                        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRER
                                                                                
                                                                                

       170       180       190       200     
....:....|....:....|....:....|....:....|....:
***********   ::                             
LLGWIQDQGGWvrpvtp----------------------------
           dgllsysptptwqtvtifvagvltasltiwkkmg
                 fgqll                       
© 1998-2019