Dataset for protein Bak1 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEMVTLPLEPSSTMGQVGRQLAI
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************   : :                              
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVvtrlgks-----------------------------
                                            prgfferrekfmikpnagsgcrwspltsphplsvse

   
...
   
---
nkl
© 1998-2019