Dataset for protein Bok of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPFPGRLAEVCAVLLRLGDELEMI
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************:.   :      .:*:. . :. .: .       .  .:* . 
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGmtwlpvvwlyrvgsGvcvsvvrqpqppmvhhpvdcqgslVrst
                                     ipsgkipsdlaeaa lagdclqgaheaapaalgaalcef lkr

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
 .  *   ... .     :: . .*   *: .     *.: :*:        
lctwLrrrsgwtgvsklvvqtspsLvvlWvlg---sfGrllqAs--------
carc elpgdqcdslgcklnhdgg rsh lgaalcha qfak affvllper
© 1998-2019