Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 : . ::  *  .                    : .  : .:. :*  
--------mdgsgeqprgggstsseqimktgalllqgfiqdRagrmggetpelgleqvpqdastkklseclkrigdeL--
mevlrrss------------p------vrqtkevgrsyvhy lqqeqlswsapertdpvpvtrlpevcsvmlqvarq ev
 asgqgpgvpaqeimepfps-ptekevaadaea f e  fa hl a eaeg aapaa emgglha p at g l    al
        pf adcddaddr   d  l                                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :::         :*     *  :*:.:*. * :.**.**:*  ..  *.:       . ::  :     
---------dsnmelqrmiaavdtDsprevFfrvAaemFsdGnfnWGrVVaLfyfaskLvlkalctkvpelirtimgwtl
irpsvyrryarqlqaslqsltpva n---- tki tsl es -it  k  s ysvgyr avhvyrrgqtgfvhqvvrfvg
 gddin nv aefn m  heq t  aay y la  sqi  a           lg  ag   dcvqqal a lgaltdcla
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:* :*  :  *:  .***   *                                                          
dF-lRerllgWiqdqGGWvrpLt--------------------------g--------------------------l-v-
e mv rtiat lrrr   tgv spphsptplgplglsvptigvppspfw-hmsdqplihrvpndlsmtldllvtsd-l-t
     ks  r  aq    ddl k                        yf                           cv s
                   aa d                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .  .                                                            
pdpmprsppwvlppiplgsl-------------------------sl--w------------------------------
------cvwlctavvsverfkfydnpltsplvgpcpylcpltppc--mc-prgcplaeslkcllslspgrpplllwdthm
tngplkthtiqavtclfaqv                      lta  ti kk                            
g  gi   a    l f  g                                                             

       330       340       350       360       370         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
----------------------------------------------gameffllf----
adsdhlcgwsahrlahhleedglrpstaldffcinygifqgggadl------f--lper
                                             m vvrr -ms    
                                               lkaa  kl    
© 1998-2019