Dataset for protein Bax of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************************************************  
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWvr
                                                                              dg

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *:                        ::*                                     *.*   .* : .:
pLt------------------------ywG------------------------------------tPtWqtvtIpvesv
l spphsptplgplglsvptigvppspff hmsdqplihrvpndlsmtldllvtsdllvtpdpmprc p clpp flagl

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       ..**  * .                                                
----------------------ptcSLtiWpr------------------------------------------------
kfydnpltsplvgpcpylcpltlpa  mc kkgcplaeslkcllslspgrpplllwdthmadsdhlcgwsahrlahhlee

       330       340       350     
....:....|....:....|....:....|....:
                         :*        
-------------------------mG--------
dglrpstaldffcinygifqgggadl ameffllf
© 1998-2019