Dataset for protein BAX-like of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------Mevlrrssvfaaev------ldvfd---------------------------------------------
mmvrteylncgasyqggghlmsv-rrqqiyy-clsfceaclrtagpvatilpyhfrvlllkggfpqtrfgsmadgrggqn
           lihphlqd----syflgek-l--q                                             
           rtqsktdnysqsp      giywg                                             
            mg    kqg  g       hlg                                              
            d      pe          aa                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            .    . :         ::  .::    .    :  : .       .    ::   *  :.*.*:   
-----------rsltekelvtqskalcrdyilsrlnqnglg---wskteLngsp---sntalkevsmvLlclgDeLe---
peqeprgaagggns-gdsilevgtvvlqgfvyehvqrqedsnkavtreqhgfrqdeltdpkhaklaqc qqia s dciq
           ddvvdgqpisedai-f-e  ia terp  rh  spd dlaa  qqggqvg iveq rk     nylr
           w p      dtan  - a      a i  s                 t     s   w         
           s                                                          h         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *.  *  *.      . ..*: ** :**: *: .**.**::: .*  *  .             ..   : :*  
p--yrNvarQlnIsvamenmvsdaFmgVAteIFsdGI-tWGkVVslFavAgaLavdcvrqghpatvhilvdwlgqfvRkf
-sl-g ael rm ndsslcptrev ir  yn  aa vfn  r  amyyf cr vikalvtqildiirtiissvldyl eh
 nv        l tqvqgsc q la  rd   t            hl  k ih vitan aen-qmpfectievi -q
              n    v         s                           reha   - -s    m      -
                             a                                  m              s
                                                                                

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
:  ::                                                                
lvpWlkrrGGWvsf------------------------rfafgsfvwvtagvgwgfvldavlva-----
vinfireq---egitkcclskilgkhemhkkltfeiqq--yratptcqcvamflagefttlfcirkmvr
 ys vva-   --v   vvktdpnpe nwlssa  slkcs---fsr-r------------a--yyrkek
    -     e-        fc                itt---y-skvpvasvy vv-vl-ltv  
    k     d                           l cmywlim ecaf h  k   dhalr  
                                            h                  f     
© 1998-2019