Dataset for protein Bax of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       *        
-----------------------------------------------------------------------Masyrggsn
mmvrteylncgrtqsktdkyssvgrflgeylhlwdfceaclrtagpvatilpyhfrvlllkggfpqtrfgs lihqhlqh
                                                                         dgp  gd
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :  ... :: . :    ::  .:: : : .  ** *:*.*  .:  **: *::.: *.:*.*.
pmsv-----------sgns-gdsilevgtvllqdfiyervqrqgdgnkaVTrEqLgG--sqltDPkhKklaqcLqqIgDe
leqeprgaagkylclgddvvdgqpidedaivfrgyviahinte-epsrh  s d d rpdeqq  qv evveq rk a s
----syrqqi  iyfqw         t n ---a         r                             h    
qg s           ds                                                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*: *.****:**: .   ...*** ** :**:*** *********::**.*: *.  :   :     :.*.:: :*  * 
LdgNvELQRmINdsslcptreVFMrVAyeIFsDGIfNWGRVVALFyfACrLviKalvtqipdiirtiisWvldylRehVi
 nr a    l  qvqgncvqd   a  rn  a   -         hl  k ih vitanhlen-qmpfe tiqvi -q y
            n       k      s                           re a a - -s       fv  - l
                                                                                

       250       260       270       280   
....:....|....:....|....:....|....:....|...
.::                               .:       
nwireqggwegirs--gtptwqtvgvflagvlttvlvirkm--
sflva------viryf-fsr-r-aamvasv--vvafdyyrkvr
  v -      ---   --- - -------  --   fatv  
                                           
© 1998-2019