Dataset for protein BAX-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .. .  *  :                                                       
--------------mdgsgeqPrgeg--------------ptsse--------------q-r-g--ggetpelaldpvpq
mevlrrssvfaaemasaqdrs trqecgepdspsaseeqvlvh--qimktgalllqgfi-d-a-ri--a-----------
             i   f pg pdk               erdtpevfqsyvfyrhryvheallapss-d smvslslvp
                                        afaqg           kqe a e  aerra  grpae qa
                                           p                      ap            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :      :        *  :   .       : *  :*. :*. * :.**.**:*  ..  *.:      
dastkklseclkrigdelds--nmelQrmiaavd--tdsprevFfrvAadmFsdGnfnWGrVVaLfyfaskLvlkalcak
-------rrqimmtrpsv-rry---r thlslqsptepvvydy tki ssl es -it  k  s ygvgyr avhvyrrg
sstmgqvgde ek  aliy-  dvaf  qhlq  aenat a la  ghi  a           la  ag   dcvqqa
alqaapg    ai   d n    s                                                      
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
 . ::  :     :* :.  :  *:  .***   *                  :   . .             
vpelirtimgwtldF-lrerllgWiqdqGGWdglLsyffgt-----ptwqtvtifvag-vltasltiwknmg-
qtgmvhqvvrfvve mvhktiat lrrr   vtv pl----dpglr---rlsvlvsnavf----f-v-----s
l aflgaltdclg     hc  r  aq    tda kcvvsp     siflsndvc l r  lgq-v-rrpfr 
                                a  d gn        h i aa   f    k a f llfek 
                                                                         
© 1998-2019