Dataset for protein BAX-like of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     : .        
------------------r-s---a-------dq--q--e-v-q-----r-q------r---------hsepv-pnskvt
masrngnpptsrrrtevr-r-svs-levmevf--vp-tt-v-s-syvwy-y-shsrst-iqvtwnppkgavsspdgpttk
  aaaaddgrd mkmdpp pamtisa       rtltektlllkgkild vfqereqieggipldklie iaricdganc
            eagail k gef          ia dg e f afafc d icgdle adaghaeeea   he aa la

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:   :  : :::.        .:  .            : :  ::  :* .* :.**.:: :  ..  :          
qvsrclrrigdelsy--nreltsmveslq---pt-----evflrvatslFssG-inWGrvvalfyfayrlavqvyrhkq-
slqnrmltlwqdinsrypnlysnvlrqvtvyphsktvvydylidissqm ed tft  kiivfygvgfkvvlkcvqtgmk
e gei      egirdmdfre ik anisn lednat a fa  ehi a          s la  cgmiihakkkel 
   d       da   k  q     gkl k          ae                     ad ic aa 

       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
 .  :  :      :: .: :  *:  .***      .  .         . *:   * :     *      
-pesirtivswtmefv-rnhlatWiqqqGGWegllsyfgtpt------wqviAvfaaGvltasltFwkms--
ntgmvkrvirymgtyllqktvvr mkrr   ---vkcvvntnvylryvllta iisl qfvvrrf vp--er
  allhd adclad i k riln  aa    sditaaldlsdpn ksh i    clf h lkai  nllp  
   f     a                                                            
© 1998-2019