Dataset for protein BAX-like of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :::.   .       :  .        :.  .     .  .:.   
---------------------------------eevmrtyvvyrqr-iqdafgrsptetpevaslsvpqsvttgrlse--
masgqgpgpprqecgettrsstsqsrgrvptstmqilkssslllhgqemeredamgpdkelmvqeqleppssmkqvgrvc
                 apreaeapeeqgards   f rgaffaaef    a  aagad  l laka adapk a   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *  :**:::        .:  :   :  .     : *  :*:  .:*. ..:.**.**:*  ..  *.:       . 
-vLlriGDeln----s--snmlrqlqitavst---yeyFtrvAs--smFs-gginWGrVVaLyyfayrLalkvyrtkvpg
aq kil  dieqryp-vyrtveqhrnpslqnetvvtdv lki ascql edsnft  k  s lsvgsk vvhcvqrgqte
 c      dlird efq  al  m a edadspr a fa     di              fg  ag   dalcqal a

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
::  :     :* :.  :  *:  .***      . .          . ::   * .:   :       
mvrtvvrwvldF-lrktlarWirrrGGWtvvlsyvgt------svwqvvtlvvlG-flvasffvw----
llhqltgftge mvhhrilp lqqq   qglalnlvsteppirptlltlsifsf rvvtrrltkslpmr
figaimdcla     ec  g  ad    dda kcf n  ggflnh i acla q  k a  ilkkeg
© 1998-2019