Dataset for protein Noxa of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------mpgkkarknaqpsparap---------------------
mrssgslgsrirgllesagweelvrssprthqgltsvrfgs---r----s-----t--qaagpagtagtardqagfgigm
                         lqkeafmakgkglcaqtrv-rtnr-tpvns-atr gnqptpeafgksgcclsssl
                                        mk revsksaqgtg spve   t dsl p  t   rare 
                                           h tl g f lp pglm   a                 
                                             si     aa m  a                     
                                             ec        l  -                     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------aele----vec
qlhftrgkkllsssysssplalprgheeqvqvarsrvcystqeiwrqtelpaetsesdsqtlllrnltask--atav---
p ryfcptapvaacllqwqgvrvpelaarlrkigdklyftwsapditvvmaqmrgkrniksnpt vpsptdppqdlkel 
  ar  s   r           ev fss sfavkft lcagcttealek  grpfrkstsrtmr sal prvlprpadk 
                         c   a r     nsl       a   e a   qr  s   e d --krkedei  
                                                         ak  m       lqaq a  a  
                                                                     gptd       
                                                                     egr        
                                                                       i        

       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
   :        .             :                            
atql------Rrfgdklnfrqkllnlisklfcsgt--------------------
-iciecaiqfgglqkrsflqrctfhqfaerlhcnwkiqtggkrgalgngrwntsk
rlem       tilqlidwkyqimefle---rll-eekmeafm            
 qgv       qv t vyil  vvyvmifny-tvq aced               
 p         n    fs     t m yafinpkp                    
 a         k    ah       k v   sain                    
 r               a       i t   g                       
 m                         l   f                       
 d                         c   e                       
© 1998-2019