Dataset for protein Noxa of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                         lqkeafmakgkglcaqtrv-vtn--tpv-s-a-e gnqptpeafgksgcclsssl
                                        mklrsrsksaqgtg spvr   t dsl p  t   rare 
                                           qetl q f sp pglm   a                 
                                           h si g   la m  a                     
                                             ec     a  l                        

        90       100       110       120       130       140       150       160
p ryfcptapvaacllqwqgvrvpefaarlrrigdklystwsapditavmaqmpgkkniksnptsvpsptdppqtakdk 
  ar  s   r           ev lss sfkvkft lfagcttealvk  grrfrrarsrvtr sal prvrtrvei  
                      a  ci  a a     scl      ie   e a   st  tm  i d lqkqkepae  
                                     n e                 qk  m   e   gpal  d a  

       170       180       190       200       210     
   :        .             :                            
vlem       tilqlidwkyqimefmeafqrlv-dece                
rqgv       nv t vsil  vvyvlit ispqp                    
 p         k    qh     t k yf  nikm                    
 a              fa       i v   kai                     
 m              a          t   g                       
 h                         c   f                       
© 1998-2019