Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                gtpkqps apaha gm

        90       100       110       120       130       140       150       160
pekkalt spgsetlrarqlgepppmeqipem-d-qqvdsdysvlsakesdecglelspppd-sd-sslsadlfapsdll
rksg ga  lf  malyeselgmlscvhvggfdsprcgrd   s dgv--p--a-s--rc--glcsllgkhhrqvqeqdw
  a  v        gghd rpasqtpaaplavtglhpfpg        ar-sa-fdaaatmerqgpdprrlacitdymrv
                r  fa a eas msnrsrdsyrkl        lcknedc-sl--vgdrtlvataqgpt antqg
                    n t      fdi qv sl n        dqgdpesnqplsrsatnatmkdssge safwa
                               s e  e            ttmmkr vfggark  racstdril id cy
                                                 gmgihe metve c  meyvqtt p    pr
                                                    dsa em il s   r   r        s
                                                     r      k t   p   p         

       170       180       190       200       210       220       230       240
dcplqrlpqftlthchppalg     pvsqedkatqtlygaspsqdemlec--wr                         
sashsaeaapsssahcslvaa     atetrpvsrhgplrsgtlgg-hhqstl                           
elrrgkvtvlaggpmwrg pt     slydqtedqldvadllaeeeql  ras                           
ltaa gkl slevnrsa  vp     rippgqapidraqstamdaft    rt                           
hqqp sfr   tresyd  rv     wrhepergec egerkkplls    se                           
rfti   h    n q    g      yygslwmrva dntgrvmsaa    n                            
cnl    k    m      f      lg n adqge rp  era sp    h                            
qy     v                  ha i rtel  nf  vlr  g                                 
 g     s                   q   g          i                                     
                           p              g                                     

       250       260       270       280       290       300       310       320
                                                  dteep-rlfrg      --fnhy   lsam
                                                  r----q---y-      rslptl   wpwg
                                                   raasrspw-s      nt  a       l
                                                   egrigaaagp      pg          e
                                                   ppnlagfeaa      g            
                                                   ayseveitdq      e            
                                                   l mtldd l       s            
                                                   g vdm                        
                                                   c d                          

       330       340       350       360       370       380       390       400
     asmrqs----pdlr-e     eqw     lgeqppegqwqqhra                               
     yrlplvpsef-amla              iq e aqpcf ew r                               
     varaeervsasnvwe                   q      a                                 
     gisd psldg vtf                                                             
     dnel  inpr gwh                                                             
      efh  lhgs esp                                                             
      dwt  etr  r c                                                             
        c  t      a                                                             

       410       420       430       440       450       460       470       480
                             a    v--grk--------nalyykrrlprnpkqagtqhqq npqrvwlrl
                             -    -wy---wqcmalqlhrshaagvvrllnysgaeatrm rrsmslwqv
                             r    qelnaqflalsvdwalyfkrtleffprqeeqqrllp sqnpkitni
                             f    rqclll ylftakkvdqspp  aek avyqhahdhl kfrqapygf
                             s    dnttvd egvpslvrpgvde  mkt ldhrrlekgw gewsnhfda
                             d    kfwptp pnkl t dgrr    psv vnghlsdrtf lhklffkay
                             k    pkr ir kps  s tctp     la dmalertgey hdhct hs 
                                  mvq g       v lsil         svtvgknai q dyi qp 
                                  asp           emhg         tppph     v  al r  
                                    v           qe q         r   p         g    
                                                p            i             m    

       490       500       510       520       530       540       550      
ilsivnrawrmgssapsqngg        m                                              
eaaris tfdlq  g lv                                                          
cer re w  n      l                                                          
 k  qg q  k                                                                 
 f  k  l  a                                                                 
 w     e                                                                    
© 1998-2019