Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------d--------egrql--qpaer
                             p  apg   s        rpgmmemakqps-vssecdrli-dvfrke-e--
                                                  esgpsqcveeimmaamfq-d---  -s-dq
                                                    dvppymdpdlcptplerepes  drspg
                                                     rrrlsr ltasslgtyssdm  aadts
                                                     sgsil  pf qlk hd gga  rqprm
                                                     a  ra  ay dhn mp qlp  htlnl
                                                             g   f sh ks   n qsp
                                                                 r nc hk   s vaf
                                                                   d       g k e
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---pp---------------------------------------------------------------------------
eds--epveglardgprpfplsrlvpsavscglaergl                                          
seves vt  egtg dpas  gart rsskh  cdps                                           
lggse                            tkf                                            
p alg                            m                                              
   gt                                                                           
   ra                                                                           
    l                                                                           
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qlrpgapt-----------------------------------l----p-------------------------------
g-------sadlfaqsqsldcplsrlqlfplthc     cgps-qtel-qgnpegnhggegdscphgspqgplappaspg
-pqaagdlgtagttrdl ys l g fh    pns     wrtgfrpt sdpgsgeceedsdsralrlakhhrtemgllwd
atsltslga gi   n               a       a ftigei qssdaadlmss qqlssqsqritlqlqevrls
vaarcesr                                  radlr llqrgskql    pv vlflcrsdsv dypga
rvctrcae                                  d  mq rvfslltsv    a   vakg rhet sqvce
ssdslrea                                  p  hm egtp kskp    m   e    pya  artav
pge  qmq                                     sp nfrh qqea             nq   ve dt
m      c                                     kv hn a   a              a     t rp
e      k                                        ak     p                       r
       s                                         a                              
       d                                                                        
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------p----a---mscd--------------ks-tqtpsppc--qaf-h-
pfatrsplfifsrrssllsrsssgyfsfdetdrs-sypa-pee-ee-   tpee mpgggpfagrs-sa-aslwa--n-y
ashqqeqrpasmshhgvgrlerrkavetrplsphsllssgeqhs--g   eets    psarrk--rlga--ps-gveml
sgpgpgrtntevqpaapsaaallfilgrpwegsregqarvtddkqas   vgsd    kas--agaq--tsnvpgegmqw
ttqpyavvasqlpavtqhtdreassydde drqqtenflmlmllcgm   s la    lk lgsnraqqetaarnnlida
dasccltql lghtrwmagpgftdrgpst rhildfadpfdltdrsp   a mp    ap ttrepktlrrlttrsesgg
ervi v pe wrgeelivefq  pwqfql cegdg sl  wkqrdra   g vl    vd vl qksh sggslhq  eh
 cts i  s ttag  ryvt   a itps s n n     rp elpe   l g     rr ed sglf   r qsd  nr
 pgr t    vn v   d     y m l    e a     sc aivt            l  q d na     f    ss
           a s         t   i    l       ks c qc            h                    
             q                                h            f                    
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lsam----------------------------------------------------------------------------
acgyrenimaeerqr                               lfygnagyrlhlpp asfplvlplgeqpqe see
p--vw    tsmprs                                  ap efkspf v vhpeaggdiearrhg maa
-kr-k    vrrisp                                      p  rv    r a ip qqveq d rtv
fqkl     riweea                                               g   a  fd s       
 rti     gvidgd                                               d      hr         
 tee     dnfl                                                                   
 pvr     sfat                                                                   
 lqn      d                                                                     
 anf      l                                                                     
 hc                                                                             
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------aqelrrigde---------fn--y------------------
eqngmerlp  glhg sp   s  qaepadmrrpeiwigrk-q-m---         --al-ykrrprlnsaqqaqqnqn
qrgr  q                 pegqwlqhsafvqc--qv-c-saq         lhrshlaglvfpknsgrherhrg
 h s  p                 rqqaraafqevarpwl-aallavd         wdseldqlyllkllyhgntdqll
                        alnisvww v qcvnac saqvlk         yadwfmptemaevhrratveghr
                        eppcfsem r  vtlvd epfq a          vgnperaarqrerhatdlpln 
                        sgrsggdl g  fr tp  kep l          qpqvvgqvnkargdssi a   
                        ihdlepla t  e  iw  ss  t          rlgrkl pgevpplppv g   
                        lsv  rh  l     e                  enh ie gat hkgvne     
                          t   r                            ed      s tqnte      
                          a   v                            tr      p gdq        
                          s   t                            v       v            
                          l                                w                    

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hpqmvillwwitqmhrsssw               t      ryilrl     lhnlllnswvwrrglgrggrapeqhpn
lggrqkrrllakklrqpptp               w      qllvfi      lsrafqrhenlnhapprssrhsmegg
mkdlslpvntnqgrfhkgpa               r       iaaa       cvsyyfgegeimnergannhaasssq
  rfh qmkatrpigceka                f       vtt        v vvidliwgtlpg qhhvlspnpth
  h i  a s shwq  rf                q       mfi          gfaradqfsaqs k rtm dd ar
    r  q   leyv  cg                l       f s          aicw pmdaetv    gt      
           p      v                m         f          c  l llp drr    q       
           a                                               i rrl pay            
                                                           k  k  imf            
                                                           h  i                 
                                                                                
                                                                                

       650       660       670       680       
....:....|....:....|....:....|....:....|....:..
                                               
-----------------------------------------------
rteipfrc                                       
lnq                                            
va                                             
                                               
                                               
                                               
                                               
                                               
                                               
                                               
                                               
                                               
© 1998-2019