Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                            g p      p  ap      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------lqpaer----p----------------------------aptslqtepq
      t  gg makqpsdvssecdrfegrq-e-s--eeep-qlrpgleeddvfppdlgplvwmsvvrpieddg--ps-a
      r       gr  s g mapmsqipem-r-qqvdsssavcmcdar gprefp  rncprtescglservrgfqle
               g    a aqsc tpgsfmeprcgrgdyepvadv               satf epkrk-am-at-
                    n  lak rcsadssghksgd  ssle s                 ga mv-kgrfse-qp
                    p  dr  s  d adlkpl q     d                   p    gaenvkstrl
                        h       davdtp       r                        c--dppldst
                                n tsym                                tcpa aahks
                                   nl                                 dgsi lngdd
                                                                      msfp  vpah
                                                                      it e      
                                                                      r         
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gnpp----g--------------------------------------s--l------l--p-------------------
---egnhg-sylwvptqppavtakhggprwpggprsrprgprp egd-cg-gspqgp-ap-aspgpfatrsplfifrrrs
dge-vpqpsaatca cai     al                   sllapphfaqsqhqdcq             lpmlql
rdrlasesa                                   hrqqadvlwdaseeqed             pstssg
spgaltpat                                   msprlsqsleelsaelg             vgvaph
eaqqeaglr                                   petvtrtagarhqrtsl             elsda 
aeasdldne                                   ragprlstesnetysga             nmaql 
cstrpqrc                                    dmstsepprkt apgv              dalgk 
ylcgrgn                                     cpeegai dhk    f               qeft 
qfst el                                     q v   a p      r               vgnh 
  k  d                                      g r     t                        t  
                                            a       k                           
                                                    q                           
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---sr---g------drspa--mscdkstqtpsp---------------sam-----aslr------a------------
sll-hsss-yfsfdt-----pa--sqedpa-qt-pc      qafnhyl-paspsqg---prgqaep-dm          
fppt-ccgrpkalggllelrlept-s--kdvr-lap      gergprvae-eeeemvmp-csvsrsppr          
taagahgesa    davhtstpsrh-sa--g-eege      sslrte d-gmgrapgrmfqartqesqp          
evgqllayls    aesaqpelcirraemsltlrsr      e apsl gqswavmihgrelpegpdqrl          
pdrretradn    sgfrshfgrpgeryrgasad v      a eaqq edltqpgllvatediqlhels          
at lpvflvl     syqaqsvawtglneeregq        p verg tyqpsavdrqiidtfidvitd          
    kkl  r     mm vlw lgf dvg fkvt        d ss   lswdrgisepelg seyavsw          
    ggm  t     wg i n hed qqd slm           dq   cvtllnsedisgs arvr et          
         g     v  g   vhe n s  ad                r e  ddw nwdp yftl ga          
               q        q h     p                     lr  efa    st ae          
                          p                            l  fts    k  h           
                                                          d                     
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
            lfyaaagyrlplppasfplsp p tavlplgeqppegqwmqhra                        
            nlwgnqrpkshv vpgpa       lgpaiqtesaqpcf ewar                        
            ass pkkfd rs l ds         d  t  p qt  v  aql                        
            s   yre   d                           r                             
                 fs                                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------e--iarelrrigdefn----------------------------
      qrmav hgg    g    h        r p-iw-gqk-q-ma----alyyarrlplpnsyqswvsre  hgqa 
                                 f gwvqv--qv-a--tqlhrsflkgwvfrernprtfhqf   artq 
                                 h rflrcla-faclsadwreqldplyrrkvkrrs    p   rvre 
                                   eireanlswydfflkivdnhsqttmstllpdg        lmst 
                                   dqactptd tlspvtmdgeimrfeaqa phad         igr 
                                   vvqvwfvp mggksc apgwkldfeev tlkc         lah 
                                   sstfl gn lsvl n qshv esghnf hg p             
                                   t edr sr epk    khrp h  pa  sa               
                                   q  l  i  k      etdr s  sk   v               
                                   a  g            yn q    q    t               
                                                    q      g                    
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------l-----------------------------------------------
                    hqqnhspswwrv-lrlisrllglnrglngpenrngagprpfrcv                
                    aaerqnrvptqliqswlrgnvrrglashaesqepnetqi                     
                    egmdrrqmlqliayfywdyifwhvwrhgmlhssgrls v                     
                    tslhapsavlmkffnhrmkegpspthmsegallrkq                        
                    qvrgclllfrarvrapkeltsenmhigrragmgltv                        
                    ktwl gcn isfcwlrqvsracprq avldraqqa                         
                    nryq kwf fgy tpffapdid sf rqtnl  a                          
                    sppa  ag vya k mvpt    im  a st                             
                    reie   p     a g g           rp                             
                    pdvs         v   l                                          
                    f hp         i   t                                          
                    l                i                                          
                    g                                                           

       570       580        
....:....|....:....|....:...
                            
----------------------------
                            
                            
                            
                            
                            
                            
                            
                            
                            
                            
                            
                            
                            
© 1998-2019