Dataset for protein Bmf of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  g         t lrlvhq qlep  v aavsgspshpsflklfrfrrrrr rsp q li     t   r np tds  
              c    p    l        apagagl a fa a   gc pdl    f                   
                                  m                  h                          

        90       100       110       120       130       140       150       160
                       :****                                                   :
wshpge-drpryldddyssldged    hsde-glva--rest-tgp-t-nqsys-l-g-fh----sn-wrttv-hiecq
 vftrdq---s-m-- f tm ed     eas-f--agpd-r--a--- -p--g--y- -h--vw fp-a----fqepky 
 il e   sy-n-               ykkhv f--tsq-mvpsti v  p pt m dg rhp v-f ld qi sagp 
 mv     l h                 r gas stsagsgvpfpnf n  k mn s         g     pc gvdn 
  s       l                     c   y  nti   av                   a     n- -erl 
          g                         l   n    s                           s q h  

       170       180       190       200       210       220       230       240
    :            * *        :                                                   
irgrelpg-slslndgk q -iaqthrpfliap-tptspafqqgepkshvpvvgpelg--qrarrqeveeeqnvi----a
hgq  arts-qvtrni  l rhsdqfhh h qsv          -f--rfs--dsa--phhev ghdsvlrtss-qqer-
e     anrpeaqiar      la  g     -s          n-pfc-laqh--sdsdfd     qq qrgrmerlvq
         gaiph n      g         h           k l -t  n-qvqsgr       ia    gfam sr
           ghg                  k           a e se  ir s nfn       e     etpd  t
                                                y    n r q a              sla  d
                                                l      f f k              a     

       250       260       270       280       290       300       310       320
----l-aqvk----g-qvllgcplyweymmq rrnfrs-dqalrrvfaamqsvlfhrdaiaervdqwplqaytprcstps
rqgraa--t icw -se r   h  qgrihm qheaphhgpm gplafmfltsgydvgfrfdhtaggytnvrrksvqllq
nerpvvr - ar      s      mfqle   ky lp rhl tlfyvkvfhfvvgarvl gqlrasqqltpfiftekkl
lshqehq l tl             hd t     r eg qag sgttt  rfcipftqg  h gfrvfk  h g  agca
 rp   l   h                 q     l      f lem r  na cmeevq  r i  dc     a      
 h    c                                      c q        psh  a e                
                                               i        mf                      

       330       340       350       360  
qpqsrlqppefcle i                          
© 1998-2019