Dataset for protein Bmf of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpragvfwkqyrav sgll rppa aaaa  ar  rlp  p e  p fpiesg qaprvfvtldpgaepwhhdseaetls
                                                                            d   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       ::*:                                            .        
------mep--cvee-------lEDDVFqpedgepg-qpgs-lsadlfaqs--ldcplsrlqlfplthccgpglRptsqE
wshpge---sq-mdddyssldge   esd-----t----l---------qs-------------pnswrttfqeikcq
 vf    drpryl         d     htkefglvapdrestatgi tpnl ysyl ghfh   fayk hspakhpey 
        s s                 y   v fag  qrmvppnp v    pt m dg r    sqf   av kvrf 
          h                 v   s s s   gv  saf n                 l     si qag  
                                    y   t                                s s d  
                                                                         c g    
                                                                           d    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            :                                                   
dkaTQTlgPaspsqgvMLPCGVtEEPqrLFYgnAgyrlhl-p-asfplvlplgeqppe----------------------
hrg e ps-slapnng  l rlaqd rp   ap-efkspfpvsvhpeaggd-earrqqsseeeqngmeqlpqqqqqqqrq
e q   atrgqvlhds     igkt hq   -sv-pl-rv - -r-a----i---qag rtaqrrrlqrrq         
         ppsqgsn      vaq  h   r-  l- c-    gs- ipnqqve-hd ddmmpqsrapq          
         -vqt  i      s         h  -  la    d v ashfdtser-  ggdhgq  he          
         t  r                         -s    -   drrhr  ltp  a  e                
         d                                  n   neerm  g-a                      
         v                                      s ap    e                       
                                                   a    d                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---gq--qhraEvqiarklqciadqfhrlhl---------qqhqqnqn------rvww-----------------qillf
qrqqpwvarsv-acrgqp--l-g-----e-vqly      hrn-r-rg      pl--                 rlaaa
 lhpcfaewqr qew-g-q - -   yw-rmlqv      ---r-s--      --yl                 -----
 qrrrrlvl-t ir- -se r      qdq-         slvghqhr      qm r                 lvttt
 p egqp-a l --v     m         i         rhy cklq      la g                 emfsr
   -- m q m  s      i         t         m e  f d      hr                    tyv 
    h   - -                             g      k      gg                    svm 
          i                                    a       f                     gf 
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
l------hnlalnr-enrngagpr--------------------------------------------------------
-vlqktgls-lfdgegfia-g-gagrrqpggvvrplassplsls   e  pa gtnq   l p wl              
i      --v----d----r-r--qqtwnrpstk k  g   c                                     
v      vtfg haqalvehvkqgpl      r                                               
m      qr c evlvpfdatdref       c                                               
f      fp r st t lt l awd                                                       
       yg   fp l kh r ysc                                                       
       s              wv                                                        
                                                                                
© 1998-2019